PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00107253001
Common NameGSBRNA2T00107253001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family G2-like
Protein Properties Length: 291aa    MW: 31478.9 Da    PI: 6.6325
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00107253001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like95.44.3e-30118171155
              G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                          +prl+Wtp+LH+rFv++v++L G+++A+Pkti++lm+v+gLt+e+v+SHLQkYRl
  GSBRNA2T00107253001 118 RPRLVWTPQLHKRFVDVVAHL-GIKNAVPKTIMQLMNVEGLTRENVASHLQKYRL 171
                          59*******************.********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.252113174IPR017930Myb domain
SuperFamilySSF466891.36E-19115175IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.9E-30117176IPR009057Homeodomain-like
TIGRFAMsTIGR015571.3E-23119171IPR006447Myb domain, plants
PfamPF002494.8E-8121170IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0042753Biological Processpositive regulation of circadian rhythm
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 291 aa     Download sequence    Send to blast
MGEEVRMSDY EVSGDGDRVI EWEMGLPSDE DLTSLSYSLI PPNLAMAFSI SPEKSRTMED  60
VNRASETTFS SLRSGSSGLN TSSSNNNSKQ KTSGDGVAAA AEEGDSGTED PTGKTLKRPR  120
LVWTPQLHKR FVDVVAHLGI KNAVPKTIMQ LMNVEGLTRE NVASHLQKYR LYLKRMQGLT  180
TEGPSSSDKL FSSTPVPPQS FQDIAGGNGN GQGNVSAGVP YGGQPMMQMP VYAHHMGMQG  240
YHHQSHGHDP YHQHHHGAGG FEANPYMMQQ NKFGSMASYP PVGGRSAHEN *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A5e-21117176463ARR10-B
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00014PBMTransfer from AT3G46640Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00107253001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009149967.10.0PREDICTED: transcription factor LUX-like
SwissprotQ9SNB41e-168PCL1_ARATH; Transcription factor LUX
TrEMBLA0A078EE690.0A0A078EE69_BRANA; BnaA06g17950D protein
STRINGBra018204.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM40552758
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G46640.22e-89G2-like family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]